PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0004s0390.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 365aa    MW: 41926.9 Da    PI: 6.3824
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0004s0390.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.7e-092913262055
                             HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                             +k +yps++e+  LA+ +gL+++q+ +WF N+R ++
  SapurV1A.0004s0390.1.p 291 YKWPYPSETEKVALAETTGLDQKQINNWFINQRKRH 326
                             4679*****************************885 PP

2ELK38.23.1e-13246267122
                     ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                             ELK++LlrKYsgyLgsLkqE+s
  SapurV1A.0004s0390.1.p 246 ELKNHLLRKYSGYLGSLKQELS 267
                             9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.5E-22102146IPR005540KNOX1
PfamPF037901.4E-23103145IPR005540KNOX1
SMARTSM012561.5E-29153204IPR005541KNOX2
PfamPF037911.9E-24158203IPR005541KNOX2
PROSITE profilePS5121311.243246266IPR005539ELK domain
PfamPF037892.1E-10246267IPR005539ELK domain
SMARTSM011883.0E-7246267IPR005539ELK domain
PROSITE profilePS5007112.973266329IPR001356Homeobox domain
SuperFamilySSF466897.7E-20267341IPR009057Homeodomain-like
SMARTSM003891.7E-12268333IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.2E-27271332IPR009057Homeodomain-like
CDDcd000862.26E-11278330No hitNo description
PfamPF059201.2E-16286325IPR008422Homeobox KN domain
PROSITE patternPS000270304327IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MEDYNQMSEN TTPRGNFLYA SQLLAPNSSP YGRTSSGSTV TQMPLSPFHL QSNDQCFQSD  60
THPIVKTEAS TSHAQKFHYP LLRGYQAINQ QQQGSESSSE VEAIKAKIIA HPQYSNLLEA  120
YMDCQKVGAP PEVVARLAAA RQEFESRQRS FITSRDNSKD PELDQFMEAY YDMLVKYREE  180
LTRPIQEAMD FMRRIETQLN MICHGPLRIF NSDDKSEGVG SSEDDQDNSG GETELPEIDP  240
RAEDRELKNH LLRKYSGYLG SLKQELSKKK KKGKLPKEAR QKLLSWWELH YKWPYPSETE  300
KVALAETTGL DQKQINNWFI NQRKRHWKPS EDMQFMVMDG LHPQNAALYM DGHYMGDGHY  360
RLGP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ8074820.0FJ807482.1 Populus trichocarpa KNOX transcription factor (KNOX) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002301134.10.0kn1-like family protein
SwissprotO041350.0KNAP2_MALDO; Homeobox protein knotted-1-like 2
TrEMBLL0AUU40.0L0AUU4_POPTO; KNAT1
STRINGVIT_18s0001g08380.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45843246
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-147KNOTTED-like from Arabidopsis thaliana